GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-25   Click here for help

GtoPdb Ligand ID: 5876

Synonyms: IL-17E | interleukin-17E | interleukin-25
Immunopharmacology Ligand
Comment: IL-25 shares sequence similarity with IL-17 family proteins, and shares the IL17RB cytokine receptor with IL-17B.
Species: Human
Peptide Sequence Click here for help
YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLC
PHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Tyr-Ser-His-Trp-Pro-Ser-Cys-Cys-Pro-Ser-Lys-Gly-Gln-Asp-Thr-Ser-Glu-Glu-Leu-Leu-Arg-Trp-Ser-Thr-Val-Pro-Val-Pro-Pro-Leu-Glu-Pro-Ala-Arg-Pro-Asn-Arg-His-Pro-Glu-Ser-Cys-Arg-Ala-Ser-Glu-Asp-Gly-Pro-Leu-Asn-Ser-Arg-Ala-Ile-Ser-Pro-Trp-Arg-Tyr-Glu-Leu-Asp-Arg-Asp-Leu-Asn-Arg-Leu-Pro-Gln-Asp-Leu-Tyr-His-Ala-Arg-Cys-Leu-Cys-Pro-His-Cys-Val-Ser-Leu-Gln-Thr-Gly-Ser-His-Met-Asp-Pro-Arg-Gly-Asn-Ser-Glu-Leu-Leu-Tyr-His-Asn-Gln-Thr-Val-Phe-Tyr-Arg-Arg-Pro-Cys-His-Gly-Glu-Lys-Gly-Thr-His-Lys-Gly-Tyr-Cys-Leu-Glu-Arg-Arg-Leu-Tyr-Arg-Val-Ser-Leu-Ala-Cys-Val-Cys-Val-Arg-Pro-Arg-Val-Met-Gly
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 104; predicted disulphide bond formation between cysteine residues at positions 78 and 136, and 183 and 138.
OSZAR »